PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA93G00134
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family S1Fa-like
Protein Properties Length: 73aa    MW: 7979.64 Da    PI: 10.7106
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA93G00134genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA143.83.3e-45673370
        S1FA  3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                 ++ve+kGlnPG+ivllv+gglll+flvgn+ily+yaqknlPPrkkkPvskkklk+eklkqGv+vPGe
  AA93G00134  6 AGNVESKGLNPGMIVLLVIGGLLLTFLVGNFILYTYAQKNLPPRKKKPVSKKKLKKEKLKQGVPVPGE 73
                5789***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0190131.0E-4973No hitNo description
PfamPF046899.4E-40973IPR006779DNA binding protein S1FA
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 73 aa     Download sequence    Send to blast
MADDFAGNVE SKGLNPGMIV LLVIGGLLLT FLVGNFILYT YAQKNLPPRK KKPVSKKKLK  60
KEKLKQGVPV PGE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104121.13e-26DNA-binding protein S1FA1
SwissprotQ423374e-20S1FA2_ARATH; DNA-binding protein S1FA2
TrEMBLW9SCA33e-26W9SCA3_9R
STRINGBra029784.1-P3e-24(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28232769
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G09735.16e-10S1FA-like DNA-binding protein